PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC3926_p3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB_related
Protein Properties Length: 535aa    MW: 59315.3 Da    PI: 5.8674
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC3926_p3genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.81.4e-144996148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ed  l+d+vk++G g+W+ + ++  + R++k+c++rw ++l
       RrC3926_p3 49 KGPWTSTEDGVLIDYVKRHGEGNWNNVQKHTSLARCGKSCRLRWANHL 96
                     79******************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.92146100IPR017930Myb domain
SMARTSM007174.6E-104898IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.4E-2250103IPR009057Homeodomain-like
SuperFamilySSF466895.47E-2350126IPR009057Homeodomain-like
CDDcd001671.09E-85196No hitNo description
PfamPF139213.8E-1452111No hitNo description
SMARTSM007172.3E-8101172IPR001005SANT/Myb domain
PROSITE profilePS5129410.593101174IPR017930Myb domain
CDDcd001679.12E-6104168No hitNo description
Gene3DG3DSA:1.10.10.604.4E-21104173IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 535 aa     Download sequence    Send to blast
MSYTMDESDD AMYSSIYNYE SPSTASDNIG NNGCTSSRGG RGSVLNLKKG PWTSTEDGVL  60
IDYVKRHGEG NWNNVQKHTS LARCGKSCRL RWANHLRPNL KKGAFSKEEE QVIVEMHARM  120
GNKWAQMAEL VSSIEKSIHK LILSLVLIFC VYQLPGRTDN EIKNYWNTRI KRRQRAGLPL  180
YPPGTHVVED LHWSQEYQST GVVDRRRHQE FSQLGNSKAN VLFEDLNFAN VLFEDLNFAT  240
SLLPGASDML ACNMLGAGAS SYTPPILPSH SNNIRQEFQS PERFQYAAPQ KNPRSFSISD  300
HHPMYGGNQN PSDVMMIQDS HTFTDGMLPA SKPSFGAVKL ELPSFQYSET GGFDQWKTTT  360
TPSPPQSDLL DSVDTYIQSP PPLEMDEPDC FSSCDTGLLD MLLHEAKIKA SAKHGLLLSS  420
SEKSINSTTC ATQNVPRVGE SEAFQNIWTR SEIPIPTQLS GGGNSSDSHS VIFEALAGYV  480
VKTEELDQVW EPKRGVDVTR PDALLASSWQ DQQGRFGIVR DSSSMSDALA LLLGG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-29461734107B-MYB
1h8a_C2e-284417320127MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009121136.10.0PREDICTED: transcription factor GAMYB-like isoform X1
TrEMBLM4CCW10.0M4CCW1_BRARP; Uncharacterized protein
STRINGBra002042.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38022859
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11440.10.0myb domain protein 65